RESEARCH CATALOG

Tesamorelin

Tesamorelin is listed in the Peptide Tactics catalog and available to order for research use in India, supplied as a 10 mg lyophilized vial. Tesamorelin as a molecule is the active ingredient of FDA-approved injection products; those approved products are defined by their own formulation, strength and labeling. This 10 mg research listing is not those products and is not represented as equivalent to them.

Tesamorelin is a synthetic analogue of human growth hormone-releasing factor (GRF/GHRH). Public records describe it as the 44-residue human GRF sequence with a trans-3-hexenoyl moiety on the N-terminal tyrosine. This page is a research-catalog listing. It is not an approved pharmaceutical product.

Peptide Tactics Tesamorelin 10 mg research material vial
Catalog price₹5,99910 mg • lyophilized powder

Enquiries are completed over WhatsApp or email. Peptide Tactics provides information and distribution for qualified research use. See the research-use policy before ordering.

Also written as

TH9507 · TH-9507 · GHRH analogue · GRF analogue

Compound identity

Development codeTH9507 / TH-9507(PubChem CID 16137828)
Peptide backboneYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL — the 44-residue human somatoliberin sequence(UniProt P01286)
Length44 residues, C-terminally amidated in the mature GRF sequence(UniProt P01286)
N-terminal modificationtrans-3-hexenoyl (hex-3-enoyl) moiety attached to the N-terminal tyrosine; PubChem IUPAC uses the (E) configuration(FDA label; PubChem CID 16137828; ChEBI CHEBI:63626)
Molecular formula (free-base peptide as indexed)C221H366N72O67S(PubChem CID 16137828)
Molecular weight (PubChem)5136 g/mol(PubChem CID 16137828)
Molecular weight (FDA, free-base equivalent)5135.9 Da(FDA EGRIFTA WR label)
Monoisotopic mass5132.72 Da(PubChem CID 16137828)
CAS registry number218949-48-5(PubChem CID 16137828)
PubChem CID16137828(PubChem)
UNIIMQG94M5EEO(PubChem CID 16137828)
Record namingThe PubChem synonym list includes “GHRH(1-44)”, which names the unmodified 44-residue hormone. Tesamorelin is the hexenoyl analogue of that sequence, not the unmodified hormone(PubChem CID 16137828)
Form of supplied materialNot established — see the notes below this table(catalog information)
Catalog format10 mg • lyophilized powder(catalog information)

Each row above is attributed to its source. Rows citing a database record are reference information about the molecule; rows marked catalog information describe this listing. Neither is a specification, an analytical result or a claim about any particular batch.

Research classification

Synthetic growth hormone-releasing factor (GRF/GHRH) analogue. FDA labeling for approved tesamorelin products describes the molecule as a human GRF analogue that, in vitro, binds and stimulates human GRF receptors. That is a pharmacological classification of the molecule in approved-drug labeling. It is not a statement about the contents or activity of this research vial, and this page provides no dosing or administration guidance. This catalog item is not an approved medicine.

Chemical characteristics

  • Tesamorelin is a full-length GRF(1–44) analogue. That distinguishes it from shorter GHRH-based research peptides such as GHRH(1–29) analogues, including the CJC-1295 forms discussed elsewhere in this catalog. Shared receptor-class language does not make the molecules interchangeable.
  • The sequence contains one methionine. Methionine oxidation adds approximately 16 Da and is a common cause of extra chromatographic peaks and satellite masses in peptides of this size.
  • At around 5136 g/mol the molecule sits well above the mass range of the short peptides in this catalog. Electrospray analysis is expected to produce a multiply charged envelope requiring deconvolution rather than a single readable mass.
  • The N-terminal hexenoyl modification adds mass relative to unmodified GRF(1–44). A measured mass consistent with unmodified GRF would not support identity as tesamorelin.

Analytical methods

  • Reversed-phase HPLC (RP-HPLC) is the method most commonly used to express the chromatographic purity of a synthetic peptide as a percentage of total peak area at a stated wavelength.
  • Mass spectrometry (typically ESI-MS or MALDI-TOF) is used to confirm that the observed mass of the material is consistent with the expected mass of the intended sequence.
  • Because purity figures are method-dependent, an analytical result is only interpretable alongside the method conditions and the batch it describes.

Both methods are covered in more detail in our guides to HPLC analysis of peptides and mass spectrometry for identity confirmation.

Stability and storage considerations

  • Lyophilized peptides are generally supplied as a dry solid because the removal of water slows hydrolytic degradation pathways.
  • Cold, dry, light-protected storage is the general handling expectation for lyophilized research peptides.
  • Once a peptide is taken into solution, its stability profile changes and is influenced by solvent, pH, temperature and the number of freeze-thaw cycles.
  • Storage and handling expectations for a specific batch should be taken from that batch's documentation rather than from general guidance.

See peptide stability and degradation for the chemistry behind these considerations.

What this page does not claim

  • This catalog item is 10 mg of research material. It is not EGRIFTA, EGRIFTA SV or EGRIFTA WR. It is not an approved pharmaceutical product, is not manufactured to those products’ specifications, and is not equivalent to them.
  • FDA labeling for approved tesamorelin injection products describes a tesamorelin acetate salt with the formula C221H366N72O67S · x C2H4O2 (x ≈ 7) and a free-base-equivalent mass of 5135.9 Da. That salt description belongs to the approved drug. Peptide Tactics has not established the salt form, acetate loading or peptide content of the material supplied under this listing.
  • PubChem reports a molecular weight of 5136 g/mol; the FDA label reports 5135.9 Da as a free-base equivalent. The difference is rounding of the same free-base formula, not evidence about a vial.
  • Peptide Tactics makes no claim about abdominal fat, body composition, muscle, testosterone, ageing, growth hormone levels or any clinical outcome. Pharmacological classification of the molecule is not an effect claim for this material.
  • This page does not provide dosing, reconstitution or administration instructions. Those belong to approved pharmaceutical labeling, which does not apply to this listing.
  • A PubChem record and an FDA label describe a molecule and, separately, approved drug products. Neither is a specification or an analytical result for a Peptide Tactics batch.

Batch testing

Every batch of Tesamorelin we sell has a supplier certificate of analysis and an independent laboratory report. We compare the two and sell a batch only if they match.

Both reports for your batch are available on request with every order.

We strongly encourage you to do your own independent testing. If your test results do not match the vendor reports, we offer a no-questions-asked refund.

Our guides on how to read a peptide certificate of analysis and what a purity figure does and does not mean cover what to look for in the documentation.

Ordering Tesamorelin in India

Tesamorelin is ordered through the catalog and finalised over WhatsApp or email, so that any question about specification or documentation is settled before the order is placed rather than after it. See the full guide to buying peptides in India for pricing across the catalog.

Dispatch timing. All orders are dispatched as soon as couriers are operating.

Distribution is within India. Material is supplied for in-vitro research and analytical applications only, and we do not supply for human or veterinary use.

Frequently asked questions

Can I buy tesamorelin in India from Peptide Tactics?
Yes. Tesamorelin is listed as a 10 mg lyophilized vial with the price shown on this page, available to order for research use within India. It is supplied for in-vitro research and analytical applications only. It is not an approved pharmaceutical product.
Is this EGRIFTA or an approved tesamorelin medicine?
No. Tesamorelin as a molecule is the active ingredient of FDA-approved injection products sold under names including EGRIFTA WR. Those products have defined formulations, strengths and labeling. This Peptide Tactics listing is 10 mg of research material. It is not those products and is not represented as equivalent to them.
What is tesamorelin?
Tesamorelin is a synthetic analogue of human growth hormone-releasing factor (GRF/GHRH). Public records describe the 44-residue human GRF sequence with a trans-3-hexenoyl group on the N-terminal tyrosine. In this catalog it is listed strictly as a research material.
What is the molecular weight of tesamorelin?
PubChem CID 16137828 gives a formula of C221H366N72O67S, a molecular weight of 5136 g/mol and a monoisotopic mass of 5132.72 Da. The FDA label for approved tesamorelin acetate products reports 5135.9 Da as a free-base equivalent. Those figures describe the free-base peptide as indexed, not a measurement of this listing, and a salt preparation weighs more per vial.
What is the sequence of tesamorelin?
The peptide backbone is the 44-residue human somatoliberin sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (UniProt P01286, residues 32–75), with a trans-3-hexenoyl modification on the N-terminal tyrosine and a C-terminal amide in the mature GRF sequence. The unmodified GRF sequence alone is not tesamorelin.
Does tesamorelin burn fat or build muscle?
This catalog does not make those claims, and this page is not product marketing for body-composition use. Approved tesamorelin pharmaceutical products have their own labeled indication, which belongs to those products and does not describe this research listing. We provide no dosing or administration guidance.
What documentation is available for tesamorelin?
Every batch has a supplier certificate of analysis and an independent laboratory report. We compare the two and sell a batch only if they match. Both reports for your batch are available on request with every order. We strongly encourage you to do your own independent testing — if your results do not match the vendor reports, we offer a no-questions-asked refund.
How quickly are tesamorelin orders dispatched?
All orders are dispatched as soon as couriers are operating. Orders received outside courier hours are dispatched as soon as couriers reopen. We do not quote a delivery date, because transit time is the courier's and not ours.
Can you source a peptide that is not listed?
Yes. Send the compound name, quantity and any specification that matters — salt form, purity threshold, documentation requirement — and we will investigate sourcing options and tell you what is possible, what it would cost and what documentation exists.
Is this material intended for human use?
No. Everything in this catalog is supplied for in-vitro research and analytical applications only, and not for human or veterinary use. We do not provide dosing, administration guidance or any therapeutic recommendation, and we cannot supply material for those purposes.

Sources

Can't Find the Compound You Need?

The catalog is not the full range of research materials we can look into. If you need a compound that is not listed, tell us what you are looking for and we will investigate sourcing options for it.

Useful things to include in your enquiry:

  • The compound name, and any code or CAS number you have for it.
  • Quantity per vial, and how many vials.
  • Any specification that matters to your work — salt form, purity threshold, or the analytical method you need it reported against.
  • Whether batch documentation or an independent analytical report is a requirement, so we can establish up front whether it is available.

We will tell you what we can source, what it would cost and what documentation exists. Where we cannot source something, or cannot establish its documentation, we will say so rather than take the order.

Sourcing enquiries are accepted for in-vitro research and analytical use only. We cannot supply material for human or veterinary use, and we do not advise on how any compound should be used.

Further reading